PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G275050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 584aa    MW: 67181.7 Da    PI: 7.9472
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G275050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.22.2e-2624111190
                  FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                           +fYn YA + GFs+r+s+s++ k++++i++rtf+Cs+ g r+++kk+ e+++ +r+etr+ C+a++k++++ dg ++++++e eHnH l
  Sobic.002G275050.1.p  24 QFYNVYAGDKGFSIRRSSSHNVKKSTTIKNRTFCCSRAGVRRPDKKE-ESSSYSRPETRCMCEARMKISLT-DGLYCIYEFEPEHNHIL 110
                           6********************************************99.999********************.***************99 PP

                  FAR1  90 a 90 
                           a
  Sobic.002G275050.1.p 111 A 111
                           7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.7E-2124111IPR004330FAR1 DNA binding domain
PfamPF105515.2E-29233327IPR018289MULE transposase domain
PfamPF0443417322339IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.507477522IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-5477518IPR007527Zinc finger, SWIM-type
SMARTSM005754.3E-6497524IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
VENSMEDTIP KIGMKFCTEE ETYQFYNVYA GDKGFSIRRS SSHNVKKSTT IKNRTFCCSR  60
AGVRRPDKKE ESSSYSRPET RCMCEARMKI SLTDGLYCIY EFEPEHNHIL ASSSQVHHLR  120
SPRKITKAQL ASVENAKAVG ISNKATFDLM AKEAGGVENL GFTREDMKNK LYSKRSLQIN  180
HGDTGGVLEY LEKKTSEDGK FFYSIQVDED DLITNIFWTD SKTVADYEVF GDVVCFDTTY  240
RKLNDGRPFG LLVGVNNHKK TIIFGAALLY DETAESFVWL FNTFLTAMSG KKPQTILTDE  300
DAAMAKAIKI ALPETHHRIC IWHMNQNACK HLAGVVEDYK KFNKDFQKCI YDQEDEEDFI  360
NAWNNLLDKN TFSTDMVSTQ RSESMNNELK GYISVKYDIL TFFEHFERLV ADKRYEEVKC  420
DFRATQSTPK LKSDLRILRH AARIYTPAIF KVFEEQVMQT LNCDLFYCGD SNAEKEYKIK  480
VYGKEHVVKF SASEVMVKCS CKKFEFVGIL CCHALKILDI NNIKKIPEQY ILNRWTADAK  540
VVHIKSNSET HEDPKTKLSK RRKELCRMYI YLANRAAVLY GCE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462721.10.0hypothetical protein SORBIDRAFT_02g030865, partial
TrEMBLC5X6780.0C5X678_SORBI; Putative uncharacterized protein Sb02g030865 (Fragment)
STRINGSb02g030865.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-109FAR1-related sequence 5